SCOPe 2.08: Domain d6f01b1: 6f01 B:2-80

Lineage for d6f01b1 (6f01 B:2-80)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (34 PDB entries)

8. Domain d6f01b1: 6f01 B:2-80 [356049]
   Other proteins in same PDB: d6f01a2, d6f01b2
   automated match to d1aw9a2
   complexed with br, gol, gs8, gts

Details for d6f01b1

PDB Entry: 6f01, 2.5 Å

PDB Description: arabidopsis thaliana gstf9, gso3 and gsoh bound

PDB Compounds: (B:) Glutathione S-transferase F9

SCOPe Domain Sequences for d6f01b1:

Sequence; same for both SEQRES and ATOM records:

>d6f01b1 c.47.1.0 (B:2-80) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vlkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgdy
kifesravmryvaekyrsq

Timeline for d6f01b1:

• d6f01b1 first appeared in SCOPe 2.07