Class a: All alpha proteins [46456] (290 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) |
Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
Protein automated matches [190983] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries) |
Domain d6c7db1: 6c7d B:579-916 [356031] Other proteins in same PDB: d6c7da2, d6c7db2 automated match to d5vp0b_ complexed with eoj, mg, zn |
PDB Entry: 6c7d (more details), 1.79 Å
SCOPe Domain Sequences for d6c7db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c7db1 a.211.1.0 (B:579-916) automated matches {Human (Homo sapiens) [TaxId: 9606]} ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf pkaaelyervasnrehwtkvshkftirglpsnnsldfl
Timeline for d6c7db1:
View in 3D Domains from other chains: (mouse over for more information) d6c7da1, d6c7da2, d6c7dc_, d6c7dd_ |