SCOPe 2.08: Domain d1miob_: 1mio B:

Lineage for d1miob_ (1mio B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
   contains three domains of this fold; "Helical backbone" holds domains 2 and 3
   both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
   automatically mapped to Pfam PF00148

6. Protein Nitrogenase iron-molybdenum protein, beta chain [81401] (4 species)
   both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3

7. Species Clostridium pasteurianum [TaxId:1501] [81395] (5 PDB entries)

8. Domain d1miob_: 1mio B: [35602]
   Other proteins in same PDB: d1mioa_, d1mioc_
   complexed with ca, cfm, clp, hca

Details for d1miob_

PDB Entry: 1mio, 3 Å

PDB Description: x-ray crystal structure of the nitrogenase molybdenum-iron protein from clostridium pasteurianum at 3.0 angstroms resolution

PDB Compounds: (B:) nitrogenase molybdenum iron protein (beta chain)

SCOPe Domain Sequences for d1miob_:

Sequence; same for both SEQRES and ATOM records:

>d1miob_ c.92.2.3 (B:) Nitrogenase iron-molybdenum protein, beta chain {Clostridium pasteurianum [TaxId: 1501]}
ldatpkeiverkalrinpaktcqpvgamyaalgihnclphshgsqgccsyhrtvlsrhfk
epamastssftegasvfgggsniktavknifslynpdiiavhttclsetlgddlptyisq
medagsipegklvihtntpsyvgshvtgfanmvqgivnylsentgakngkinvipgfvgp
admreikrlfeamdipyimfpdtsgvldgpttgeykmypeggtkiedlkdtgnsdltlsl
gsyasdlgaktlekkckvpfktlrtpigvsatdefimalseatgkevpasieeergqlid
lmidaqqylqgkkvallgdpdeiialskfiielgaipkyvvtgtpgmkfqkeidamlaea
giegskvkvegdffdvhqwiknegvdllisntygkfiareenipfvrfgfpimdryghyy
npkvgykgairlveeitnvildkierecteedfevvr

Timeline for d1miob_:

• d1miob_ first appeared (with stable ids) in SCOP 1.55
  
• d1miob_ appears in SCOPe 2.07