SCOPe 2.08: Domain d6dgkb_: 6dgk B:

Lineage for d6dgkb_ (6dgk B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
   beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]

4. Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family)
   automatically mapped to Pfam PF00600

5. Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
   C-terminal part of Pfam PF00600

6. Protein automated matches [190936] (7 species)
   not a true protein

7. Species Influenza a virus (strain a/brevig mission/1/1918 h1n1) [TaxId:88776] [356001] (3 PDB entries)

8. Domain d6dgkb_: 6dgk B: [356002]
   automated match to d3o9qb_
   mutant

Details for d6dgkb_

PDB Entry: 6dgk, 1.9 Å

PDB Description: crystal structure of the non-structural protein 1 (ns1) effector domain w187a mutant from the a/brevig mission/1/1918 (h1n1) strain of influenza a virus

PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d6dgkb_:

Sequence; same for both SEQRES and ATOM records:

>d6dgkb_ d.299.1.1 (B:) automated matches {Influenza a virus (strain a/brevig mission/1/1918 h1n1) [TaxId: 88776]}
asryltdmtleemsrdwfmlmpkqkvagslcirmdqaimdkniilkanfsvifdrletli
llrafteegaivgeisplpslpghtdedvknavgvliggleandntvrvsetlqrfawrs

Timeline for d6dgkb_:

• d6dgkb_ first appeared in SCOPe 2.07