SCOPe 2.08: Domain d6d0od1: 6d0o D:11-295

Lineage for d6d0od1 (6d0o D:11-295)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.0: automated matches [191672] (1 protein)
   not a true family

6. Protein automated matches [191281] (21 species)
   not a true protein

7. Species Sphingobium herbicidovorans [TaxId:1219045] [355990] (2 PDB entries)

8. Domain d6d0od1: 6d0o D:11-295 [355998]
   Other proteins in same PDB: d6d0oa2, d6d0ob2, d6d0oc2, d6d0od2
   automated match to d1otja_
   complexed with akg, co

Details for d6d0od1

PDB Entry: 6d0o, 2.3 Å

PDB Description: rdpa dioxygenase holoenzyme

PDB Compounds: (D:) (R)-phenoxypropionate/alpha-ketoglutarate-dioxygenase

SCOPe Domain Sequences for d6d0od1:

Sequence; same for both SEQRES and ATOM records:

>d6d0od1 b.82.2.0 (D:11-295) automated matches {Sphingobium herbicidovorans [TaxId: 1219045]}
rferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhiaf
srrfgpvdpvpllksiegypevqmirregdesgrvigddwhtdstfldappaavvmraid
vpehggdtgflsmytawetlsptmqatieglnvvhsatrvfgslyqaqnrrfsntsvkvm
dvdagdretvhplvvthpgsgrkglyvnqvycqriegmsekesepllsflfahatkpeft
crvrwkkdqvvvwdnlctmhyaindyhgqtrilhrttvggvrpar

Timeline for d6d0od1:

• d6d0od1 first appeared in SCOPe 2.07