Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.0: automated matches [191672] (1 protein) not a true family |
Protein automated matches [191281] (21 species) not a true protein |
Species Sphingobium herbicidovorans [TaxId:1219045] [355990] (2 PDB entries) |
Domain d6d0od1: 6d0o D:11-295 [355998] Other proteins in same PDB: d6d0oa2, d6d0ob2, d6d0oc2, d6d0od2 automated match to d1otja_ complexed with akg, co |
PDB Entry: 6d0o (more details), 2.3 Å
SCOPe Domain Sequences for d6d0od1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d0od1 b.82.2.0 (D:11-295) automated matches {Sphingobium herbicidovorans [TaxId: 1219045]} rferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhiaf srrfgpvdpvpllksiegypevqmirregdesgrvigddwhtdstfldappaavvmraid vpehggdtgflsmytawetlsptmqatieglnvvhsatrvfgslyqaqnrrfsntsvkvm dvdagdretvhplvvthpgsgrkglyvnqvycqriegmsekesepllsflfahatkpeft crvrwkkdqvvvwdnlctmhyaindyhgqtrilhrttvggvrpar
Timeline for d6d0od1: