Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries) |
Domain d6cjkc1: 6cjk C:1-107 [355995] automated match to d4jo4l1 complexed with act, gol |
PDB Entry: 6cjk (more details), 1.8 Å
SCOPe Domain Sequences for d6cjkc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cjkc1 b.1.1.0 (C:1-107) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} divmtqtpasveaavggtvaikcqasqsirsylawyqqkpgqppklliyeasklasgvps rfsgsgsgtqftltisgvecddaatyycqrnydsysgayypngfgggtevvvk
Timeline for d6cjkc1:
View in 3D Domains from other chains: (mouse over for more information) d6cjka1, d6cjka2, d6cjkb_, d6cjkd_ |