SCOPe 2.08: Domain d6cjkc1: 6cjk C:1-107

Lineage for d6cjkc1 (6cjk C:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries)

8. Domain d6cjkc1: 6cjk C:1-107 [355995]
   automated match to d4jo4l1
   complexed with act, gol

Details for d6cjkc1

PDB Entry: 6cjk, 1.8 Å

PDB Description: anti hiv fab 10a

PDB Compounds: (C:) Immunoglobulin Fab light chain

SCOPe Domain Sequences for d6cjkc1:

Sequence; same for both SEQRES and ATOM records:

>d6cjkc1 b.1.1.0 (C:1-107) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
divmtqtpasveaavggtvaikcqasqsirsylawyqqkpgqppklliyeasklasgvps
rfsgsgsgtqftltisgvecddaatyycqrnydsysgayypngfgggtevvvk

Timeline for d6cjkc1:

• d6cjkc1 first appeared in SCOPe 2.07