SCOPe 2.08: Domain d6an4a_: 6an4 A:

Lineage for d6an4a_ (6an4 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family)
   common fold is elaborated with additional secondary structures
   automatically mapped to Pfam PF01288

5. Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein)

6. Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (4 species)

7. Species Escherichia coli [TaxId:562] [55086] (49 PDB entries)
   Uniprot P26281

8. Domain d6an4a_: 6an4 A: [355979]
   automated match to d1q0na_
   complexed with cl, j1f

Details for d6an4a_

PDB Entry: 6an4, 1.47 Å

PDB Description: crystal structure of escherichia coli hppk in complex with bisubstrate analogue inhibitor hp-39 (j1f)

PDB Compounds: (A:) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase

SCOPe Domain Sequences for d6an4a_:

Sequence, based on SEQRES records:

>d6an4a_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli [TaxId: 562]}
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

Sequence, based on observed residues (ATOM records):

>d6an4a_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli [TaxId: 562]}
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvprtldldimlfgnevinterltvphydmknrgfmlwp
lfeiapelvfpdgemlrqilhtrafdklnkw

Timeline for d6an4a_:

• d6an4a_ first appeared in SCOPe 2.07