![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.3: VHL [49468] (1 family) ![]() automatically mapped to Pfam PF01847 |
![]() | Family b.3.3.1: VHL [49469] (2 proteins) |
![]() | Protein VHL [49470] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49471] (38 PDB entries) |
![]() | Domain d6gmni_: 6gmn I: [355966] Other proteins in same PDB: d6gmna_, d6gmnb_, d6gmnd_, d6gmne_, d6gmng_, d6gmnh_, d6gmnj_, d6gmnk1, d6gmnk2 automated match to d1lqbc_ complexed with act, f4e |
PDB Entry: 6gmn (more details), 1.94 Å
SCOPe Domain Sequences for d6gmni_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gmni_ b.3.3.1 (I:) VHL {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerltqeri
Timeline for d6gmni_: