SCOPe 2.08: Domain d5oanc1: 5oan C:20-226

Lineage for d5oanc1 (5oan C:20-226)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d5oanc1: 5oan C:20-226 [355948]
   Other proteins in same PDB: d5oanc2
   automated match to d2w8gc_
   complexed with act, cl, gly; mutant

Details for d5oanc1

PDB Entry: 5oan, 2.6 Å

PDB Description: crystal structure of mutant achbp in complex with glycine (t53f, q74r, y110a, i135s, g162e, s206ccp_kgtg)

PDB Compounds: (C:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d5oanc1:

Sequence; same for both SEQRES and ATOM records:

>d5oanc1 b.96.1.0 (C:20-226) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhykgtgepyidvnlvvkfrerra

Timeline for d5oanc1:

• d5oanc1 first appeared in SCOPe 2.07