Lineage for d1aq2__ (1aq2 -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75078Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
  4. 75079Superfamily c.91.1: PEP carboxykinase-like [53795] (2 families) (S)
  5. 75080Family c.91.1.1: Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) [53796] (1 protein)
  6. 75081Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) [53797] (1 species)
  7. 75082Species Escherichia coli [TaxId:562] [53798] (3 PDB entries)
  8. 75085Domain d1aq2__: 1aq2 - [35591]

Details for d1aq2__

PDB Entry: 1aq2 (more details), 1.9 Å

PDB Description: phosphoenolpyruvate carboxykinase

SCOP Domain Sequences for d1aq2__:

Sequence, based on SEQRES records: (download)

>d1aq2__ c.91.1.1 (-) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) {Escherichia coli}
nngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgift
grspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvda
fcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeq
glnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgekgdv
avffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepeiyna
irrdallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifltad
afgvlppvsrltadqtqyhflsgftaklagtergiteptptfsacfgaaflslhptqyae
vlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnlaip
telpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl

Sequence, based on observed residues (ATOM records): (download)

>d1aq2__ c.91.1.1 (-) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) {Escherichia coli}
nngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgift
grspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvda
fcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeq
glnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgekgdv
avffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepeiyna
irrdallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifltad
afgvlppvsrltadqtqyhflsgftaklagtiteptptfsacfgaaflslhptqyaevlv
krmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnlaiptel
pgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl

SCOP Domain Coordinates for d1aq2__:

Click to download the PDB-style file with coordinates for d1aq2__.
(The format of our PDB-style files is described here.)

Timeline for d1aq2__: