Lineage for d5y2uc_ (5y2u C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467369Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2467370Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2467371Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 2467423Protein automated matches [190196] (7 species)
    not a true protein
  7. 2467443Species Human (Homo sapiens) [TaxId:9606] [186938] (16 PDB entries)
  8. 3055847Domain d5y2uc_: 5y2u C: [355909]
    automated match to d2hhja_
    complexed with azn, cl, mes

Details for d5y2uc_

PDB Entry: 5y2u (more details), 1.98 Å

PDB Description: x-ray structure of phosphoglycerate mutase 1(pgam1) complexed with a small molecule
PDB Compounds: (C:) phosphoglycerate mutase 1

SCOPe Domain Sequences for d5y2uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y2uc_ c.60.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqk
rairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydv
ppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrv
liaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgd

SCOPe Domain Coordinates for d5y2uc_:

Click to download the PDB-style file with coordinates for d5y2uc_.
(The format of our PDB-style files is described here.)

Timeline for d5y2uc_:

  • d5y2uc_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-09