Lineage for d1oen__ (1oen -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27947Fold c.91: Phosphoenolpyruvate carboxykinase (ATP-oxaloacetate carboxy-liase) [53794] (1 superfamily)
  4. 27948Superfamily c.91.1: Phosphoenolpyruvate carboxykinase (ATP-oxaloacetate carboxy-liase) [53795] (1 family) (S)
  5. 27949Family c.91.1.1: Phosphoenolpyruvate carboxykinase (ATP-oxaloacetate carboxy-liase) [53796] (1 protein)
  6. 27950Protein Phosphoenolpyruvate carboxykinase (ATP-oxaloacetate carboxy-liase) [53797] (1 species)
  7. 27951Species Escherichia coli [TaxId:562] [53798] (3 PDB entries)
  8. 27953Domain d1oen__: 1oen - [35590]

Details for d1oen__

PDB Entry: 1oen (more details), 1.9 Å

PDB Description: phosphoenolpyruvate carboxykinase

SCOP Domain Sequences for d1oen__:

Sequence, based on SEQRES records: (download)

>d1oen__ c.91.1.1 (-) Phosphoenolpyruvate carboxykinase (ATP-oxaloacetate carboxy-liase) {Escherichia coli}
gltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgr
spkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafc
ganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgl
nsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgeagdvav
ffglsgsgkttlstdparrligddehgwdddgvfnfeggsyaktiklskeaepeiyaair
rdallenvtvraggtidfddgsktentrvsypiyhidnivkpvskaghatkvifltadaf
gvlppvsrltadqtqyhflsgftaaaagtergiteptptfsacfgaaflslhptqyaevl
vkrmqaagaqaylvntgwngtgkrisaadtraiidailngsldnaetftlpmfnlaipte
lpgvdtgildprntyaspagwqekaetlaklfidnfdkytdtpagaalvaagpal

Sequence, based on observed residues (ATOM records): (download)

>d1oen__ c.91.1.1 (-) Phosphoenolpyruvate carboxykinase (ATP-oxaloacetate carboxy-liase) {Escherichia coli}
gltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgr
spkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafc
ganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgl
nsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgeagdvav
ffglsgsgkttlstdparrligddehgwdddgvfnfeggsyaktiklskeaepeiyaair
rdallenvtvraggtidfddgsktentrvsypiyhidnivkpvskaghatkvifltadaf
gvlppvsrltadqtqyhflsgftaaaaptptfsacfgaaflslhptqyaevlvkrmqaag
aqaylvntgwngtgkrisaadtraiidailngsldnaetftlpmfnlaiptelpgvdtgi
ldprntyagwqekaetlaklfidnfdkytdtpagaalvaagpal

SCOP Domain Coordinates for d1oen__:

Click to download the PDB-style file with coordinates for d1oen__.
(The format of our PDB-style files is described here.)

Timeline for d1oen__: