Class b: All beta proteins [48724] (180 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
Protein Acetylcholine binding protein (ACHBP) [63714] (1 species) |
Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (9 PDB entries) |
Domain d5y2qd_: 5y2q D: [355876] automated match to d1ux2a_ complexed with 8l3 |
PDB Entry: 5y2q (more details), 2.36 Å
SCOPe Domain Sequences for d5y2qd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y2qd_ b.96.1.1 (D:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr tlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn svtysccpeayedvevslnfrkk
Timeline for d5y2qd_:
View in 3D Domains from other chains: (mouse over for more information) d5y2qa_, d5y2qb_, d5y2qc_, d5y2qe_ |