SCOPe 2.08: Domain d1cbfa1: 1cbf A:21-251

Lineage for d1cbfa1 (1cbf A:21-251)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families)

5. Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
   Pfam PF00590

6. Protein Cobalt precorrin-4 methyltransferase CbiF [53792] (1 species)

7. Species Bacillus megaterium [TaxId:1404] [53793] (2 PDB entries)

8. Domain d1cbfa1: 1cbf A:21-251 [35587]
   Other proteins in same PDB: d1cbfa2
   complexed with po4, sah

Details for d1cbfa1

PDB Entry: 1cbf, 2.4 Å

PDB Description: the x-ray structure of a cobalamin biosynthetic enzyme, cobalt precorrin-4 methyltransferase, cbif

PDB Compounds: (A:) cobalt-precorrin-4 transmethylase

SCOPe Domain Sequences for d1cbfa1:

Sequence; same for both SEQRES and ATOM records:

>d1cbfa1 c.90.1.1 (A:21-251) Cobalt precorrin-4 methyltransferase CbiF {Bacillus megaterium [TaxId: 1404]}
mklyiigagpgdpdlitvkglkllqqadvvlyadslvsqdliakskpgaevlktagmhle
emvgtmldrmregkmvvrvhtgdpamygaimeqmvllkregvdieivpgvtsvfaaaaaa
eaeltipdltqtviltraegrtpvpefekltdlakhkctialflsstltkkvmkefinag
wsedtpvvvvykatwpdekivrttvkdlddamrtngirkqamilagwaldp

Timeline for d1cbfa1:

• d1cbfa1 first appeared (with stable ids) in SCOP 1.55, called d1cbf__
  
• d1cbfa1 appears in SCOPe 2.07