SCOPe 2.07: Domain d5oija_: 5oij A:

Lineage for d5oija_ (5oij A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Synaptic protein PSD-95 [50162] (2 species)
   Synonym: synapse associated protein 90, sap90
   duplication: contains three PDZ domains

7. Species Human (Homo sapiens) [TaxId:9606] [74932] (11 PDB entries)

8. Domain d5oija_: 5oij A: [355860]
   automated match to d5w72a_
   mutant

Details for d5oija_

PDB Entry: 5oij, 1.8 Å

PDB Description: crystal structure of the third pdz domain of psd-95 protein d332g mutant: space group i4122

PDB Compounds: (A:) Disks large homolog 4

SCOPe Domain Sequences for d5oija_:

Sequence; same for both SEQRES and ATOM records:

>d5oija_ b.36.1.1 (A:) Synaptic protein PSD-95 {Human (Homo sapiens) [TaxId: 9606]}
ipreprrivihrgstglgfnivggeggegifisfilaggpadlsgelrkgdqilsvngvd
lrnasheqaaialknagqtvtiiaqykpeeysrfeak

Timeline for d5oija_:

• d5oija_ is new in SCOPe 2.07-stable
  
• d5oija_ does not appear in SCOPe 2.08