Lineage for d5y35c_ (5y35 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890965Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2890966Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2890967Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 2891019Protein automated matches [190196] (7 species)
    not a true protein
  7. 2891039Species Human (Homo sapiens) [TaxId:9606] [186938] (20 PDB entries)
  8. 2891061Domain d5y35c_: 5y35 C: [355859]
    automated match to d2hhja_
    complexed with 8lf, cl, mes

Details for d5y35c_

PDB Entry: 5y35 (more details), 1.99 Å

PDB Description: phosphoglycerate mutase 1 complexed with a small molecule inhibitor kh1
PDB Compounds: (C:) phosphoglycerate mutase 1

SCOPe Domain Sequences for d5y35c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y35c_ c.60.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqk
rairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydv
ppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrv
liaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeet

SCOPe Domain Coordinates for d5y35c_:

Click to download the PDB-style file with coordinates for d5y35c_.
(The format of our PDB-style files is described here.)

Timeline for d5y35c_: