Lineage for d6gmnd_ (6gmn D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2501137Protein Elongin B [54246] (2 species)
  7. 2501138Species Human (Homo sapiens) [TaxId:9606] [54247] (49 PDB entries)
  8. 3055795Domain d6gmnd_: 6gmn D: [355857]
    Other proteins in same PDB: d6gmnb_, d6gmnc_, d6gmne_, d6gmnf_, d6gmnh_, d6gmni_, d6gmnk1, d6gmnk2, d6gmnl_
    automated match to d1lqba_
    complexed with act, f4e

Details for d6gmnd_

PDB Entry: 6gmn (more details), 1.94 Å

PDB Description: pvhl:elob:eloc in complex with methyl 4h-furo[3,2-b]pyrrole-5- carboxylate
PDB Compounds: (D:) Elongin-B

SCOPe Domain Sequences for d6gmnd_:

Sequence, based on SEQRES records: (download)

>d6gmnd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdv

Sequence, based on observed residues (ATOM records): (download)

>d6gmnd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafrdtfealciepfssppelpdv

SCOPe Domain Coordinates for d6gmnd_:

Click to download the PDB-style file with coordinates for d6gmnd_.
(The format of our PDB-style files is described here.)

Timeline for d6gmnd_: