Lineage for d5y52b1 (5y52 B:8-158)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966494Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. 2966729Protein automated matches [254656] (4 species)
    not a true protein
  7. 2966814Species Bacillus sp. [TaxId:36824] [312567] (12 PDB entries)
  8. 2966845Domain d5y52b1: 5y52 B:8-158 [355852]
    automated match to d1j2ga1
    complexed with aza, edo, oxy, so4; mutant

Details for d5y52b1

PDB Entry: 5y52 (more details), 1.63 Å

PDB Description: crystal structure of highly active btuo mutant p287g improved by humidity control at 83% rh
PDB Compounds: (B:) Uric acid degradation bifunctional protein

SCOPe Domain Sequences for d5y52b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y52b1 d.96.1.4 (B:8-158) automated matches {Bacillus sp. [TaxId: 36824]}
vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
vkngnraaselvfkksrneyataylnmvrne

SCOPe Domain Coordinates for d5y52b1:

Click to download the PDB-style file with coordinates for d5y52b1.
(The format of our PDB-style files is described here.)

Timeline for d5y52b1: