Class b: All beta proteins [48724] (178 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein Synaptic protein PSD-95 [50162] (2 species) Synonym: synapse associated protein 90, sap90 duplication: contains three PDZ domains |
Species Human (Homo sapiens) [TaxId:9606] [74932] (11 PDB entries) |
Domain d5ohwc_: 5ohw C: [355824] automated match to d5w72a_ complexed with so4 |
PDB Entry: 5ohw (more details), 1.55 Å
SCOPe Domain Sequences for d5ohwc_:
Sequence, based on SEQRES records: (download)
>d5ohwc_ b.36.1.1 (C:) Synaptic protein PSD-95 {Human (Homo sapiens) [TaxId: 9606]} reprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqilsvngvdlr nasheqaaialknagqtvtiiaqyk
>d5ohwc_ b.36.1.1 (C:) Synaptic protein PSD-95 {Human (Homo sapiens) [TaxId: 9606]} reprrivihrgglgfnivgggegifisfilaggpadlsgelrkgdqilsvngvdlrnash eqaaialknagqtvtiiaqyk
Timeline for d5ohwc_: