Class b: All beta proteins [48724] (178 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein automated matches [190055] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries) |
Domain d5oiha_: 5oih A: [355801] automated match to d3i4wa_ complexed with gol, so4; mutant |
PDB Entry: 5oih (more details), 1.05 Å
SCOPe Domain Sequences for d5oiha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oiha_ b.36.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dipreprrivihrgstglgfnivggeggegifisfilaggpadlsgelrkgdqilsvngv dlrnasheqaaialknagqtvtiiaqykpeeysrfea
Timeline for d5oiha_: