Lineage for d5oiha_ (5oih A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2395484Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2395833Protein automated matches [190055] (6 species)
    not a true protein
  7. 2395842Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries)
  8. 2395846Domain d5oiha_: 5oih A: [355801]
    automated match to d3i4wa_
    complexed with gol, so4; mutant

Details for d5oiha_

PDB Entry: 5oih (more details), 1.05 Å

PDB Description: crystal structure of the third pdz domain of psd-95 protein d332g mutant: space group p43
PDB Compounds: (A:) Disks large homolog 4

SCOPe Domain Sequences for d5oiha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oiha_ b.36.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dipreprrivihrgstglgfnivggeggegifisfilaggpadlsgelrkgdqilsvngv
dlrnasheqaaialknagqtvtiiaqykpeeysrfea

SCOPe Domain Coordinates for d5oiha_:

Click to download the PDB-style file with coordinates for d5oiha_.
(The format of our PDB-style files is described here.)

Timeline for d5oiha_:

  • d5oiha_ is new in SCOPe 2.07-stable
  • d5oiha_ does not appear in SCOPe 2.08