Class b: All beta proteins [48724] (178 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein automated matches [190055] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries) |
Domain d5oibc_: 5oib C: [355787] automated match to d3i4wa_ complexed with so4 |
PDB Entry: 5oib (more details), 1.5 Å
SCOPe Domain Sequences for d5oibc_:
Sequence, based on SEQRES records: (download)
>d5oibc_ b.36.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} reprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqilsvngvdlr nasheqaaialknagqtvtiiaqykpeeysrf
>d5oibc_ b.36.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} reprrivihrglgfnivggedgegifisfilaggpadlsgelrkgdqilsvngvdlrnas heqaaialknagqtvtiiaqykpeeysrf
Timeline for d5oibc_: