Lineage for d6gmxf_ (6gmx F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768790Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2768791Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2768792Protein VHL [49470] (1 species)
  7. 2768793Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries)
  8. 2768900Domain d6gmxf_: 6gmx F: [355770]
    Other proteins in same PDB: d6gmxa_, d6gmxb_, d6gmxd_, d6gmxe1, d6gmxe2, d6gmxg_, d6gmxh_, d6gmxj_, d6gmxk1, d6gmxk2
    automated match to d1lqbc_
    complexed with act, f7b, ipa

Details for d6gmxf_

PDB Entry: 6gmx (more details), 2.53 Å

PDB Description: pvhl:elob:eloc in complex with 6-chlorothiochroman-4-one
PDB Compounds: (F:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d6gmxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gmxf_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]}
lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda
gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr
slyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d6gmxf_:

Click to download the PDB-style file with coordinates for d6gmxf_.
(The format of our PDB-style files is described here.)

Timeline for d6gmxf_: