Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Elongin C [54699] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries) |
Domain d6gmnb_: 6gmn B: [355751] Other proteins in same PDB: d6gmna_, d6gmnc_, d6gmnd_, d6gmnf_, d6gmng_, d6gmni_, d6gmnj_, d6gmnk2, d6gmnl_ automated match to d1lm8c_ complexed with act, f4e |
PDB Entry: 6gmn (more details), 1.94 Å
SCOPe Domain Sequences for d6gmnb_:
Sequence, based on SEQRES records: (download)
>d6gmnb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
>d6gmnb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlstnevnfreipshvlskvcmyftykvrytn ssteipefpiapeialellmaanfldc
Timeline for d6gmnb_: