SCOPe 2.07: Domain d6gmnc_: 6gmn C:

Lineage for d6gmnc_ (6gmn C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.3: VHL [49468] (1 family)
   automatically mapped to Pfam PF01847

5. Family b.3.3.1: VHL [49469] (2 proteins)

6. Protein VHL [49470] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49471] (38 PDB entries)

8. Domain d6gmnc_: 6gmn C: [355734]
   Other proteins in same PDB: d6gmna_, d6gmnb_, d6gmnd_, d6gmne_, d6gmng_, d6gmnh_, d6gmnj_, d6gmnk1, d6gmnk2
   automated match to d1lqbc_
   complexed with act, f4e

Details for d6gmnc_

PDB Entry: 6gmn, 1.94 Å

PDB Description: pvhl:elob:eloc in complex with methyl 4h-furo[3,2-b]pyrrole-5- carboxylate

PDB Compounds: (C:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d6gmnc_:

Sequence, based on SEQRES records:

>d6gmnc_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerl

Sequence, based on observed residues (ATOM records):

>d6gmnc_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvpifanitlpvytlkerclqvvrslvkpenyrrldivrsl
yedledhpnvqkdlerl

Timeline for d6gmnc_: