SCOPe 2.08: Domain d6fksb1: 6fks B:3-299

Lineage for d6fksb1 (6fks B:3-299)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (33 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [355716] (12 PDB entries)

8. Domain d6fksb1: 6fks B:3-299 [355725]
   Other proteins in same PDB: d6fksb2
   automated match to d5vj0a_
   complexed with gol, hem, mg

Details for d6fksb1

PDB Entry: 6fks, 1.6 Å

PDB Description: crystal structure of a dye-decolorizing peroxidase from klebsiella pneumoniae (kpdyp)

PDB Compounds: (B:) Iron-dependent peroxidase

SCOPe Domain Sequences for d6fksb1:

Sequence; same for both SEQRES and ATOM records:

>d6fksb1 d.58.4.0 (B:3-299) automated matches {Klebsiella pneumoniae [TaxId: 573]}
qvqsgilpehcraaiwieanlkgdvnalreaskifvdnvatfqakfpdaklgavvafgnn
vwrqlsggegadelkdfpvygkglapstqydllihilsarhevnfsvaqaalaafgdaid
vkeeihgfrwveerdlsgfvdgtenpageetrrevavikdgvdaggsyvfvqrwehnlkq
lnrmsvpdqemmigrtkdaneeidgderpvtshlsrvdlkedgkglkivrqslpygtasg
thglyfcaycarlynieqqllsmfgdtdgkrdamlrftkpvtggyyfapsleriqal

Timeline for d6fksb1:

• d6fksb1 first appeared in SCOPe 2.07