SCOPe 2.08: Domain d6btqb_: 6btq B:

Lineage for d6btqb_ (6btq B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188286] (69 PDB entries)

8. Domain d6btqb_: 6btq B: [355715]
   automated match to d3edha_
   complexed with e8s, edo, scn, zn

Details for d6btqb_

PDB Entry: 6btq, 1.75 Å

PDB Description: bmp1 complexed with a hydroxamate - compound 2

PDB Compounds: (B:) Bone morphogenetic protein 1

SCOPe Domain Sequences for d6btqb_:

Sequence; same for both SEQRES and ATOM records:

>d6btqb_ d.92.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aatsrpervwpdgvipfviggnftgsqravfrqamrhwekhtcvtflertdedsyivfty
rpcgccsyvgrrgggpqaisigkncdkfgivvhelghvvgfwhehtrpdrdrhvsivren
iqpgqeynflkmepqeveslgetydfdsimhyarntfsrgifldtivpkyevngvkppig
qrtrlskgdiaqarklykcpa

Timeline for d6btqb_:

• d6btqb_ first appeared in SCOPe 2.07