SCOPe 2.08: Domain d6cvya1: 6cvy A:1004-1180

Lineage for d6cvya1 (6cvy A:1004-1180)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (12 species)
   not a true protein

7. Species Hepacivirus c [TaxId:11103] [355696] (21 PDB entries)

8. Domain d6cvya1: 6cvy A:1004-1180 [355697]
   Other proteins in same PDB: d6cvya2
   automated match to d5epna_
   complexed with fhd, gol, so4, zn

Details for d6cvya1

PDB Entry: 6cvy, 1.8 Å

PDB Description: crystal structure of hcv ns3/4a wt protease in complex with aj-21 (mk- 5172 linear analogue)

PDB Compounds: (A:) NS3 protease

SCOPe Domain Sequences for d6cvya1:

Sequence; same for both SEQRES and ATOM records:

>d6cvya1 b.47.1.3 (A:1004-1180) automated matches {Hepacivirus c [TaxId: 11103]}
tayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsingvlwtvyhgagtrt
iaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvtrhadvipvrrrgdsr
gsllsprpisylkgssggpllcpaghavgifraavctrgvakavdfipveslettmr

Timeline for d6cvya1:

• d6cvya1 first appeared in SCOPe 2.07