SCOPe 2.07: Domain d6btob_: 6bto B:

Lineage for d6btob_ (6bto B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188286] (68 PDB entries)

8. Domain d6btob_: 6bto B: [355693]
   automated match to d3edha_
   complexed with e8p, edo, scn, zn

Details for d6btob_

PDB Entry: 6bto, 2.05 Å

PDB Description: bmp1 complexed with (2~{s})-2-[[(1~{r},3~{s},4~{s})-2-[(2~{r})-2-[2- (oxidanylamino)-2-oxidanylidene-ethyl]heptanoyl]-2- azabicyclo[2.2.1]heptan-3-yl]carbonylamino]-2-phenyl-ethanoic acid

PDB Compounds: (B:) Bone morphogenetic protein 1

SCOPe Domain Sequences for d6btob_:

Sequence; same for both SEQRES and ATOM records:

>d6btob_ d.92.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aatsrpervwpdgvipfviggnftgsqravfrqamrhwekhtcvtflertdedsyivfty
rpcgccsyvgrrgggpqaisigkncdkfgivvhelghvvgfwhehtrpdrdrhvsivren
iqpgqeynflkmepqeveslgetydfdsimhyarntfsrgifldtivpkyevngvkppig
qrtrlskgdiaqarklykcp

Timeline for d6btob_:

• d6btob_ is new in SCOPe 2.07-stable
  
• d6btob_ appears in the current release, SCOPe 2.08