Lineage for d6btob_ (6bto B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530208Species Human (Homo sapiens) [TaxId:9606] [188286] (57 PDB entries)
  8. 3055631Domain d6btob_: 6bto B: [355693]
    automated match to d3edha_
    complexed with e8p, edo, scn, zn

Details for d6btob_

PDB Entry: 6bto (more details), 2.05 Å

PDB Description: bmp1 complexed with (2~{s})-2-[[(1~{r},3~{s},4~{s})-2-[(2~{r})-2-[2- (oxidanylamino)-2-oxidanylidene-ethyl]heptanoyl]-2- azabicyclo[2.2.1]heptan-3-yl]carbonylamino]-2-phenyl-ethanoic acid
PDB Compounds: (B:) Bone morphogenetic protein 1

SCOPe Domain Sequences for d6btob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6btob_ d.92.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aatsrpervwpdgvipfviggnftgsqravfrqamrhwekhtcvtflertdedsyivfty
rpcgccsyvgrrgggpqaisigkncdkfgivvhelghvvgfwhehtrpdrdrhvsivren
iqpgqeynflkmepqeveslgetydfdsimhyarntfsrgifldtivpkyevngvkppig
qrtrlskgdiaqarklykcp

SCOPe Domain Coordinates for d6btob_:

Click to download the PDB-style file with coordinates for d6btob_.
(The format of our PDB-style files is described here.)

Timeline for d6btob_:

  • d6btob_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-09