Class b: All beta proteins [48724] (180 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (5 species) not a true protein |
Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries) |
Domain d5oadd_: 5oad D: [355675] automated match to d2w8gc_ complexed with edo, epe, nag; mutant |
PDB Entry: 5oad (more details), 2.1 Å
SCOPe Domain Sequences for d5oadd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oadd_ b.96.1.0 (D:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt rqvqhysccpepyidvnlvvkfrer
Timeline for d5oadd_:
View in 3D Domains from other chains: (mouse over for more information) d5oada_, d5oadb_, d5oadc_, d5oade_ |