Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.4: TM0189-like [142789] (4 proteins) Part of Pfam PF01497 that include some other superfamily members |
Protein Enterochelin uptake protein CeuE [142792] (1 species) |
Species Campylobacter jejuni [TaxId:197] [142793] (11 PDB entries) Uniprot Q0P8Q4 44-330 |
Domain d5od5a1: 5od5 A:24-310 [355670] Other proteins in same PDB: d5od5a2, d5od5b2, d5od5c2 automated match to d3zkwb_ complexed with 7pg, 95b, 9rt, fe, ir, po4, rir |
PDB Entry: 5od5 (more details), 1.9 Å
SCOPe Domain Sequences for d5od5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5od5a1 c.92.2.4 (A:24-310) Enterochelin uptake protein CeuE {Campylobacter jejuni [TaxId: 197]} lpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlpk ylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanfl ssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgpq srfgiihdvlginavdenikvgthgksinsefileknpdyifvvdrnvilgnkeraqgil dnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk
Timeline for d5od5a1:
View in 3D Domains from other chains: (mouse over for more information) d5od5b1, d5od5b2, d5od5c1, d5od5c2 |