Lineage for d5yy5h_ (5yy5 H:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (21 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (223 PDB entries)
  8. 3055599Domain d5yy5h_: 5yy5 H: [355661]
    Other proteins in same PDB: d5yy5c_, d5yy5d_
    automated match to d1dqlh_
    complexed with nag

Details for d5yy5h_

PDB Entry: 5yy5 (more details), 2.8 Å

PDB Description: structural definition of a unique neutralization epitope on the receptor-binding domain of mers-cov spike glycoprotein
PDB Compounds: (H:) heavy chain

SCOPe Domain Sequences for d5yy5h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yy5h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpgrslrlscaasgftfsnyamywvrqapgkglewvalisydistdyy
adsvkgrftisrdnskntiylqmnnlrtedtalyyctntyywgqgtlvtvs

SCOPe Domain Coordinates for d5yy5h_:

Click to download the PDB-style file with coordinates for d5yy5h_.
(The format of our PDB-style files is described here.)

Timeline for d5yy5h_:

  • d5yy5h_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-02