Lineage for d5yy5d_ (5yy5 D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (26 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1264 PDB entries)
  8. 3055595Domain d5yy5d_: 5yy5 D: [355657]
    Other proteins in same PDB: d5yy5h_
    automated match to d3t0xa_
    complexed with nag

Details for d5yy5d_

PDB Entry: 5yy5 (more details), 2.8 Å

PDB Description: structural definition of a unique neutralization epitope on the receptor-binding domain of mers-cov spike glycoprotein
PDB Compounds: (D:) light chain

SCOPe Domain Sequences for d5yy5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yy5d_ b.1.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltqspsasgtpgqrvtiscsgsssnignnyvywyqqlpgtapklliywndqrpsgvpdrf
sgsksgtsaslaisglrsedeadyycaawddslsgavfgggtqlt

SCOPe Domain Coordinates for d5yy5d_:

Click to download the PDB-style file with coordinates for d5yy5d_.
(The format of our PDB-style files is described here.)

Timeline for d5yy5d_: