Lineage for d6fn3a2 (6fn3 A:208-494)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721241Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 2721242Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) (S)
    automatically mapped to Pfam PF03441
  5. 2721307Family a.99.1.0: automated matches [231382] (1 protein)
    not a true family
  6. 2721308Protein automated matches [231383] (3 species)
    not a true protein
  7. 2721319Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [355320] (3 PDB entries)
  8. 2721321Domain d6fn3a2: 6fn3 A:208-494 [355650]
    Other proteins in same PDB: d6fn3a1
    automated match to d4i6ga2
    complexed with fad, gol, mes, po4

Details for d6fn3a2

PDB Entry: 6fn3 (more details), 1.9 Å

PDB Description: x-ray structure of animal-like cryptochrome from chlamydomonas reinhardtii
PDB Compounds: (A:) Cryptochrome photoreceptor

SCOPe Domain Sequences for d6fn3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fn3a2 a.99.1.0 (A:208-494) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ltvfkggetealarleaafqdpkwvagfqkpdtdpsawekpattvlspylkfgclsarlf
harllevyrrhpahsqppvslrgqllwreffytvgsttpnfhrmagnpvckqidwddnpe
flaawreartgfpwidaimtqlvtwgwmhhlarhsvacfltrgdlyvswergmevfeehl
idqdhylnaanwmwlsasaffsqyfrvyspvvfgkkydpegrfirkflpvlkdmpakyiy
epwtaplevqrkagcvvgrdypapivdhavaskaciarmaaayrrsk

SCOPe Domain Coordinates for d6fn3a2:

Click to download the PDB-style file with coordinates for d6fn3a2.
(The format of our PDB-style files is described here.)

Timeline for d6fn3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6fn3a1