SCOPe 2.07: Domain d5zgma_: 5zgm A:

Lineage for d5zgma_ (5zgm A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.4: Parvalbumin [47492] (3 proteins)
   6-helices; array of 3 hairpins, closed
   made with two-helical hairpin and two EF-hands

6. Protein automated matches [254433] (4 species)
   not a true protein

7. Species Triakis semifasciata [TaxId:30493] [355610] (1 PDB entry)

8. Domain d5zgma_: 5zgm A: [355648]
   automated match to d5pala_
   complexed with ca, so4

Details for d5zgma_

PDB Entry: 5zgm, 1.4 Å

PDB Description: crystal structure of parvalbumin spvi, the major allergens in mustelus griseus

PDB Compounds: (A:) Parvalbumin SPVI

SCOPe Domain Sequences for d5zgma_:

Sequence; same for both SEQRES and ATOM records:

>d5zgma_ a.39.1.4 (A:) automated matches {Triakis semifasciata [TaxId: 30493]}
pmtkvlkaddinkavsafkdpgtfdykrffqlvglkgkseaqvkevfeildkdqsgfiee
eelksvlkgfsahgrdlsdtetkallaagdsdhdgkigadefakmvaqa

Timeline for d5zgma_:

• d5zgma_ is new in SCOPe 2.07-stable
  
• d5zgma_ appears in the current release, SCOPe 2.08