SCOPe 2.08: Domain d5wmga1: 5wmg A:44-168

Lineage for d5wmga1 (5wmg A:44-168)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d5wmga1: 5wmg A:44-168 [355631]
   Other proteins in same PDB: d5wmga2
   automated match to d5egub_
   complexed with 6jf, edo

Details for d5wmga1

PDB Entry: 5wmg, 1.19 Å

PDB Description: n-terminal bromodomain of brd4 in complex with otx-015

PDB Compounds: (A:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d5wmga1:

Sequence; same for both SEQRES and ATOM records:

>d5wmga1 a.29.2.0 (A:44-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpayykiikt
pmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkine
lptee

Timeline for d5wmga1:

• d5wmga1 first appeared in SCOPe 2.07