Lineage for d5zgmb_ (5zgm B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323645Family a.39.1.4: Parvalbumin [47492] (3 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 2323706Protein automated matches [254433] (4 species)
    not a true protein
  7. 2323715Species Triakis semifasciata [TaxId:30493] [355610] (1 PDB entry)
  8. 2323717Domain d5zgmb_: 5zgm B: [355611]
    automated match to d5pala_
    complexed with ca, so4

Details for d5zgmb_

PDB Entry: 5zgm (more details), 1.4 Å

PDB Description: crystal structure of parvalbumin spvi, the major allergens in mustelus griseus
PDB Compounds: (B:) Parvalbumin SPVI

SCOPe Domain Sequences for d5zgmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zgmb_ a.39.1.4 (B:) automated matches {Triakis semifasciata [TaxId: 30493]}
pmtkvlkaddinkavsafkdpgtfdykrffqlvglkgkseaqvkevfeildkdqsgfiee
eelksvlkgfsahgrdlsdtetkallaagdsdhdgkigadefakmvaqa

SCOPe Domain Coordinates for d5zgmb_:

Click to download the PDB-style file with coordinates for d5zgmb_.
(The format of our PDB-style files is described here.)

Timeline for d5zgmb_: