Lineage for d5ogna1 (5ogn A:3-260)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811457Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2811458Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2811459Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2812658Protein automated matches [190681] (2 species)
    not a true protein
  7. 2812668Species Human (Homo sapiens) [TaxId:9606] [187805] (57 PDB entries)
  8. 2812671Domain d5ogna1: 5ogn A:3-260 [355594]
    Other proteins in same PDB: d5ogna2
    automated match to d3ml5a_
    complexed with b8b, zn

Details for d5ogna1

PDB Entry: 5ogn (more details), 1.1 Å

PDB Description: metalacarborane inhibitors of carbonic anhydrase ix
PDB Compounds: (A:) Carbonic anhydrase 2

SCOPe Domain Sequences for d5ogna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ogna1 b.74.1.1 (A:3-260) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprg
llpesldywtypgslttpplaecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

SCOPe Domain Coordinates for d5ogna1:

Click to download the PDB-style file with coordinates for d5ogna1.
(The format of our PDB-style files is described here.)

Timeline for d5ogna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ogna2
View in 3D
Domains from other chains:
(mouse over for more information)
d5ognb_