Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.0: automated matches [227142] (1 protein) not a true family |
Protein automated matches [226844] (11 species) not a true protein |
Species Foot-and-mouth disease virus - type c [TaxId:12116] [355542] (1 PDB entry) |
Domain d6gvva1: 6gvv A:1-470 [355543] Other proteins in same PDB: d6gvva2 automated match to d5xe0a_ complexed with gol; mutant |
PDB Entry: 6gvv (more details), 2.35 Å
SCOPe Domain Sequences for d6gvva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gvva1 e.8.1.0 (A:1-470) automated matches {Foot-and-mouth disease virus - type c [TaxId: 12116]} glivdtrdveervhvarktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgda
Timeline for d6gvva1: