Lineage for d5og9b_ (5og9 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 2331534Protein automated matches [190068] (10 species)
    not a true protein
  7. 2331535Species Bacillus megaterium [TaxId:1404] [188479] (6 PDB entries)
  8. 3055459Domain d5og9b_: 5og9 B: [355521]
    automated match to d4zf8a_
    complexed with cl, hem, tes, zn; mutant

Details for d5og9b_

PDB Entry: 5og9 (more details), 2.09 Å

PDB Description: the bm3 mutant wifi-wc heme domain in complex with testosterone
PDB Compounds: (B:) Bifunctional cytochrome P450/NADPH--P450 reductase

SCOPe Domain Sequences for d5og9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5og9b_ a.104.1.1 (B:) automated matches {Bacillus megaterium [TaxId: 1404]}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgwvtrwlssqrlikeac
desrfdknliqalkfvrdffgdglitswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvracd
eamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkd
petgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpv
psykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhr
dktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfd
fedhtnyeldiketltlkpegfvvkakskkiplg

SCOPe Domain Coordinates for d5og9b_:

Click to download the PDB-style file with coordinates for d5og9b_.
(The format of our PDB-style files is described here.)

Timeline for d5og9b_:

  • d5og9b_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-02