SCOPe 2.08: Domain d5oajj1: 5oaj J:20-236

Lineage for d5oajj1 (5oaj J:20-236)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d5oajj1: 5oaj J:20-236 [355508]
   Other proteins in same PDB: d5oajb2, d5oajj2
   automated match to d2w8gc_
   complexed with edo, flc, nag, tkt; mutant

Details for d5oajj1

PDB Entry: 5oaj, 2.47 Å

PDB Description: crystal structure of mutant achbp in complex with tropisetron (t53f, q74r, y110a, i135s, g162e)

PDB Compounds: (J:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d5oajj1:

Sequence, based on SEQRES records:

>d5oajj1 b.96.1.0 (J:20-236) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrerragngffrnlfd

Sequence, based on observed residues (ATOM records):

>d5oajj1 b.96.1.0 (J:20-236) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrerrfd

Timeline for d5oajj1:

• d5oajj1 first appeared in SCOPe 2.07