Lineage for d6b1wb_ (6b1w B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014498Species Klebsiella pneumoniae [TaxId:573] [225260] (114 PDB entries)
  8. 3014584Domain d6b1wb_: 6b1w B: [355408]
    automated match to d3c5aa_
    complexed with c8v, cl, so4

Details for d6b1wb_

PDB Entry: 6b1w (more details), 1.73 Å

PDB Description: crystal structure kpc-2 beta-lactamase complexed with wck 5107 by co- crystallization
PDB Compounds: (B:) Carbapenem-hydrolyzing beta-lactamase KPC

SCOPe Domain Sequences for d6b1wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b1wb_ e.3.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
ltnlvaepfakleqdfggsigvyamdtgsgatvsyraeerfplcssfkgflaaavlarsq
qqaglldtpirygknalvpwspisekylttgmtvaelsaaavqysdnaaanlllkelggp
agltafmrsigdttfrldrwelelnsaipgdardtsspravteslqkltlgsalaapqrq
qfvdwlkgnttgnhriraavpadwavgdktgtcgvygtandyavvwptgrapivlavytr
apnkddkhseaviaaaarlaleglg

SCOPe Domain Coordinates for d6b1wb_:

Click to download the PDB-style file with coordinates for d6b1wb_.
(The format of our PDB-style files is described here.)

Timeline for d6b1wb_: