Lineage for d5obas1 (5oba S:4-176)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702643Species Mouse (Mus musculus) [TaxId:10090] [355187] (7 PDB entries)
  8. 2702765Domain d5obas1: 5oba S:4-176 [355392]
    Other proteins in same PDB: d5obaf2, d5obag2, d5obal2, d5obar2, d5obas2, d5obav2, d5obax2
    automated match to d5up8a_
    complexed with fe

Details for d5obas1

PDB Entry: 5oba (more details), 2.85 Å

PDB Description: structure of a modified mouse h-chain ferritin with a lanthanide binding motif
PDB Compounds: (S:) ferritin heavy chain

SCOPe Domain Sequences for d5obas1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5obas1 a.25.1.1 (S:4-176) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg

SCOPe Domain Coordinates for d5obas1:

Click to download the PDB-style file with coordinates for d5obas1.
(The format of our PDB-style files is described here.)

Timeline for d5obas1:

2702765
d5obas1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5obas2