Lineage for d5xrtg_ (5xrt G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775589Species Influenza a virus (a/swine/minnesota/a01134337/2010(h3n2)) [TaxId:1159784] [355255] (2 PDB entries)
  8. 2775597Domain d5xrtg_: 5xrt G: [355360]
    Other proteins in same PDB: d5xrtb_, d5xrtd_, d5xrtf_, d5xrth_
    automated match to d1hgja_
    complexed with cac, nag

Details for d5xrtg_

PDB Entry: 5xrt (more details), 3.15 Å

PDB Description: crystal structure of a/minnesota/11/2010 (h3n2) influenza virus hemagglutinin
PDB Compounds: (G:) Hemagglutinin

SCOPe Domain Sequences for d5xrtg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xrtg_ b.19.1.2 (G:) Hemagglutinin {Influenza a virus (a/swine/minnesota/a01134337/2010(h3n2)) [TaxId: 1159784]}
nsmatlclghhavpngtlvktitddqievtnatelvqssstgricnsphqildgknctli
dallgdphcddfqnkewdlfverstaysncypyyvpdyatlrslvassgnleftqesfnw
tgvaqdgssyacrrgsvnsffsrlnwlynlnykypeqnvtmpnndkfdklyiwgvhhpgt
dkdqtnlyvqasgrvivstkrsqqtvipnigsrpwvrgvssiisiywtivkpgdillins
tgnliaprgyfkiqsgkssimrsdahidecnsecitpngsipndkpfqnvnkitygacpr
yvkqntlklatgmrnvpek

SCOPe Domain Coordinates for d5xrtg_:

Click to download the PDB-style file with coordinates for d5xrtg_.
(The format of our PDB-style files is described here.)

Timeline for d5xrtg_: