SCOPe 2.08: Domain d5y23b_: 5y23 B:

Lineage for d5y23b_ (5y23 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Pseudoazurin [49522] (4 species)

7. Species Achromobacter cycloclastes [TaxId:223] [49525] (14 PDB entries)

8. Domain d5y23b_: 5y23 B: [355280]
   automated match to d2jkwa_
   complexed with cu, gol

Details for d5y23b_

PDB Entry: 5y23, 1.4 Å

PDB Description: x-ray crystal structure of pseudoazurin met16phe variant

PDB Compounds: (B:) pseudoazurin

SCOPe Domain Sequences for d5y23b_:

Sequence; same for both SEQRES and ATOM records:

>d5y23b_ b.6.1.1 (B:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]}
adfevhmlnkgkdgafvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
algn

Timeline for d5y23b_:

• d5y23b_ first appeared in SCOPe 2.07