Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [355187] (7 PDB entries) |
Domain d5obau_: 5oba U: [355269] Other proteins in same PDB: d5obaf2, d5obag2, d5obal2, d5obar2, d5obas2, d5obav2, d5obax2 automated match to d5up8a_ complexed with fe |
PDB Entry: 5oba (more details), 2.85 Å
SCOPe Domain Sequences for d5obau_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5obau_ a.25.1.1 (U:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
Timeline for d5obau_:
View in 3D Domains from other chains: (mouse over for more information) d5obaa_, d5obab_, d5obac_, d5obad_, d5obae_, d5obaf1, d5obaf2, d5obag1, d5obag2, d5obah_, d5obai_, d5obaj_, d5obak_, d5obal1, d5obal2, d5obam_, d5oban_, d5obao_, d5obap_, d5obaq_, d5obar1, d5obar2, d5obas1, d5obas2, d5obat_, d5obav1, d5obav2, d5obaw_, d5obax1, d5obax2 |