Lineage for d5obbn_ (5obb N:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702643Species Mouse (Mus musculus) [TaxId:10090] [355187] (7 PDB entries)
  8. 2702735Domain d5obbn_: 5obb N: [355230]
    Other proteins in same PDB: d5obba2, d5obbb2, d5obbf2, d5obbg2, d5obbh2, d5obbi2, d5obbj2, d5obbk2, d5obbl2, d5obbm2, d5obbo2, d5obbp2, d5obbq2, d5obbr2, d5obbs2, d5obbt2, d5obbu2, d5obbv2, d5obbw2, d5obbx2
    automated match to d5up8a_
    complexed with tb

Details for d5obbn_

PDB Entry: 5obb (more details), 2.65 Å

PDB Description: structure of a modified mouse h chain ferritin with a lanthanide binding motif in complex with terbium
PDB Compounds: (N:) ferritin heavy chain

SCOPe Domain Sequences for d5obbn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5obbn_ a.25.1.1 (N:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg

SCOPe Domain Coordinates for d5obbn_:

Click to download the PDB-style file with coordinates for d5obbn_.
(The format of our PDB-style files is described here.)

Timeline for d5obbn_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5obba1, d5obba2, d5obbb1, d5obbb2, d5obbc_, d5obbd_, d5obbe_, d5obbf1, d5obbf2, d5obbg1, d5obbg2, d5obbh1, d5obbh2, d5obbi1, d5obbi2, d5obbj1, d5obbj2, d5obbk1, d5obbk2, d5obbl1, d5obbl2, d5obbm1, d5obbm2, d5obbo1, d5obbo2, d5obbp1, d5obbp2, d5obbq1, d5obbq2, d5obbr1, d5obbr2, d5obbs1, d5obbs2, d5obbt1, d5obbt2, d5obbu1, d5obbu2, d5obbv1, d5obbv2, d5obbw1, d5obbw2, d5obbx1, d5obbx2