Lineage for d6fnnc1 (6fnn C:1-78)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (26 species)
    not a true protein
  7. 2502642Species Candidatus caldiarchaeum [TaxId:311458] [274223] (5 PDB entries)
  8. 3055098Domain d6fnnc1: 6fnn C:1-78 [355160]
    Other proteins in same PDB: d6fnnc2, d6fnnd2
    automated match to d2mqja_
    complexed with so4, zn

Details for d6fnnc1

PDB Entry: 6fnn (more details), 1.85 Å

PDB Description: caldiarchaeum subterraneum ubiquitin:rpn11-homolog complex
PDB Compounds: (C:) Ubiquitin-like protein

SCOPe Domain Sequences for d6fnnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fnnc1 d.15.1.0 (C:1-78) automated matches {Candidatus caldiarchaeum [TaxId: 311458]}
mkikivpavgggsplelevapnatvgavrtkvcamkklppdttrltykgralkdtetles
lgvadgdkfvlitrtvgg

SCOPe Domain Coordinates for d6fnnc1:

Click to download the PDB-style file with coordinates for d6fnnc1.
(The format of our PDB-style files is described here.)

Timeline for d6fnnc1:

  • d6fnnc1 appears in periodic updates to SCOPe 2.07 starting on 2018-07-26

View in 3D
Domains from same chain:
(mouse over for more information)
d6fnnc2