SCOPe 2.08: Domain d6dhqf2: 6dhq F:209-501

Lineage for d6dhqf2 (6dhq F:209-501)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein automated matches [227005] (6 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [225674] (6 PDB entries)

8. Domain d6dhqf2: 6dhq F:209-501 [355156]
   Other proteins in same PDB: d6dhqa1, d6dhqb1, d6dhqc1, d6dhqd1, d6dhqe1, d6dhqf1
   automated match to d3etda2
   complexed with glu, gtp, ndp

Details for d6dhqf2

PDB Entry: 6dhq, 2.3 Å

PDB Description: bovine glutamate dehydrogenase complexed with nadph, glutamate, and gtp

PDB Compounds: (F:) Glutamate dehydrogenase 1, mitochondrial

SCOPe Domain Sequences for d6dhqf2:

Sequence; same for both SEQRES and ATOM records:

>d6dhqf2 c.2.1.7 (F:209-501) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfineasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft

Timeline for d6dhqf2:

• d6dhqf2 first appeared in SCOPe 2.07