Lineage for d6fhfa_ (6fhf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831217Protein automated matches [190057] (28 species)
    not a true protein
  7. 2831298Species Escherichia coli [TaxId:562] [355142] (1 PDB entry)
  8. 2831299Domain d6fhfa_: 6fhf A: [355143]
    automated match to d3mmda_
    complexed with na

Details for d6fhfa_

PDB Entry: 6fhf (more details), 1.85 Å

PDB Description: highly active enzymes by automated modular backbone assembly and sequence design
PDB Compounds: (A:) Design

SCOPe Domain Sequences for d6fhfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fhfa_ c.1.8.3 (A:) automated matches {Escherichia coli [TaxId: 562]}
gsefkphisalnapslaqrykdyfyigaavepyqttkekdakmlqrhfnmivaenamkpa
aleptegnfqwadadrivqfakengmelrfhtlvwhnqtpdwffldregkpmveetdpqk
reenrelllqrlenhiravvlrykddiknwdvvnevvepndpggmrnspwyqitgteyie
vafraareaggediklymndynteqepkreyiyrlikkllekgvpidgvghqahvtidrp
pvdeikktiqrfadlgldnqiteldvslygwpprpayptydaipeerfqaqadryrqlfe
lfeelkdhisavtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpaywaiinhk

SCOPe Domain Coordinates for d6fhfa_:

Click to download the PDB-style file with coordinates for d6fhfa_.
(The format of our PDB-style files is described here.)

Timeline for d6fhfa_: